PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g19610.22.p
Common NameBRADI_2g19610, LOC100827663
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family HB-PHD
Protein Properties Length: 886aa    MW: 97282.8 Da    PI: 4.7121
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g19610.22.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox39.21.2e-12695747456
                        -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        R++f +   ++L e+F+ ++yp+++ +e LA++lgLt +qV+ WF  rR+k +
  Bradi2g19610.22.p 695 RRQFGPIIYQRLHEHFKTDQYPKRAVKESLANELGLTFQQVSKWFETRRYKTR 747
                        7778888889*****************************************87 PP

2PHD40.18.5e-14226281151
                        SBTTTSS..TCTTSSEEEBSS.SSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
                PHD   1 rCkvCgk..sdeegelvlCdg.CkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                        +C+ C++   + +++++lCdg C++ fH+kCl+++l ++++p g   wlC+ C++k
  Bradi2g19610.22.p 226 ICATCSSqyVTLNNDIILCDGvCDRGFHQKCLNPPLLTKDIPAGdeGWLCPACDCK 281
                        6******87667********77********************9999*******985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF579031.2E-12220284IPR011011Zinc finger, FYVE/PHD-type
Gene3DG3DSA:3.30.40.105.0E-12223280IPR013083Zinc finger, RING/FYVE/PHD-type
PROSITE profilePS5001610.923224281IPR019787Zinc finger, PHD-finger
SMARTSM002492.0E-10226279IPR001965Zinc finger, PHD-type
PfamPF006281.1E-10226281IPR019787Zinc finger, PHD-finger
CDDcd155048.70E-24227278No hitNo description
PROSITE patternPS013590227278IPR019786Zinc finger, PHD-type, conserved site
PROSITE profilePS5007114.107689749IPR001356Homeobox domain
SMARTSM003894.3E-10691753IPR001356Homeobox domain
SuperFamilySSF466897.27E-12694754IPR009057Homeodomain-like
CDDcd000863.70E-11694747No hitNo description
PfamPF000464.2E-10695747IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.3E-12695754IPR009057Homeodomain-like
PROSITE patternPS000270724747IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 886 aa     Download sequence    Send to blast
MDMNKGTGSG CAEDNVETGN YANSSQNPET LDNQSLPYTS QSLENNTGQR KNYKRTANRG  60
RKGYRVLADR NYPLRSSDCD TTVRVLRSRS AANKPPSDSA HTLVHSAANK FPSDSVHTLV  120
QPAAKRIKRG RPTKKGPNNE FSKIRQRVRY ILNRMNYEQS LLEAYANEGW KRQRPEKELE  180
RAKEEIVRCK LRIREAFQNL DSLLSMGKLD ESLFDNEGKI SCEDIICATC SSQYVTLNND  240
IILCDGVCDR GFHQKCLNPP LLTKDIPAGD EGWLCPACDC KIDCIDVINE LQGTNLSISD  300
SWEKVFPETA ALAHGTIPKD AFDLPSEDSE DSDFDPNIAE EHVTGHEEGS SEEDEDEGSD  360
SDDSNFVTTC DNSEHLKEKE KVDDLGLPSE DSEDDDYDPA GPDSDKDIKE KQDESDFTSD  420
SDDFCAEIAK SCGRDEVSSG AKDAYGEAPS DSSDGEEWSG KSTSEKGDEE RNEVDSFLRK  480
SSRGTGTVQQ SNDFLPQSAR QSLDPDGLVN GQHPGKLTSD VSNNKTNRKP LNNKEEVDDL  540
GLPSEDSEDD DYDPAGPDSD KDIEKKQSSS NESDYSSASD DFCGEIAKSC GREGVPSGAK  600
AVSGRRQDQS LDCKKLYDEA CREASSDSSD GEDWSGKCTP EKDSEKQSDT CRRTGAVRQS  660
NGSTPDNARQ SLHRTNGQHT EELLTSDGSS STVHRRQFGP IIYQRLHEHF KTDQYPKRAV  720
KESLANELGL TFQQVSKWFE TRRYKTRIAA KKNDSCVKNH SIKENQSSVA AHIEATDPKD  780
LGKKLNVCKN GAANDVMASG ILNGGIKQDS PLKQDTSGGL GTHVSPPGSS PKGDPIENHG  840
NNTSSRCVGK PKDGYTGNVV LALPVVDDRT KEAAMRELKK RKTGS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014754574.10.0PREDICTED: homeobox protein HOX1A-like isoform X2
SwissprotP466051e-155HOX1A_MAIZE; Homeobox protein HOX1A
TrEMBLA0A0Q3IHL00.0A0A0Q3IHL0_BRADI; Uncharacterized protein
STRINGBRADI2G19610.20.0(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19510.12e-73Homeodomain-like protein with RING/FYVE/PHD-type zinc finger domain